Product Added to your Cart
x

-------- OR --------

NZD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPROMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Default
Default Default
$0.00
Scented Candles
Black Opium type scented candle
Black Opium type scented candle
Black Raspberry & Vanilla scented candle
Black Raspberry & Vanilla scented candle
Brazilian Bum Bum type scented candle
Brazilian Bum Bum type scented candle
Cloud type scented candle
Cloud type scented candle
Fantasy type scented candle
Fantasy type scented candle
Flowerbomb type scented candle
Flowerbomb type scented candle
French pear
French pear
J'Adore type scented candle
J'Adore type scented candle
Lady Million type Scented Soy Candle
Lady Million type Scented Soy Candle
Lychee & Guava scented candle
Lychee & Guava scented candle
Pink Marshmellow scented candle
Pink Marshmellow scented candle
Pink Sugar inspired scented candle
Pink Sugar inspired scented candle
Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i